Polyclonal Antibody against Human SDHB

Rs. 53,277.00
SKU

Product Name: Anti-SDHB
Product Number: HPA002868
Lot Number: H118169
Gene Description: succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQ AYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIA EIKKMMATY
Purification Method: Affinity purified using the PrEST antigen as an affinity ligand
Verified Species Reactivity: Human, Mouse, Rat
Recommended Applications: IHC (Immunohistochemistry)
                                           - Antibody dilution: 1:1000 - 1:2500
                                           - Working concentration: 1-4 µg/ml
                                           - Retrieval method: HIER pH6 WB
                                           - Working concentration: 0.4 µg/ml ICC-IF 
                                           - Fixation/Permeabilization: Triton X-100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative
Unit size: 100 µl
Concentration: 0.2 mg/ml
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

You recently viewed

Clear recently viewed
Print Friendly and PDF